PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_02507996C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 318aa    MW: 34997.7 Da    PI: 6.7805
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_02507996C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.83e-141462148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           rg+W++eEd  l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
  Traes_1BL_02507996C.1 14 RGPWSPEEDAMLKAYIEERGTGnNWIALPHKIGLKRCGKSCRLRWLNYL 62
                           89*********************************************97 PP

2Myb_DNA-binding40.27.8e-1369111246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +T+eEd  + ++    G++ W+ Ia+ ++ gRt++++k++w++
  Traes_1BL_02507996C.1  69 GDFTPEEDSTICKLYISIGSR-WSIIAAQLP-GRTDNDVKNYWNT 111
                            789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.957962IPR017930Myb domain
SuperFamilySSF466894.9E-2612109IPR009057Homeodomain-like
SMARTSM007171.3E-101364IPR001005SANT/Myb domain
PfamPF002493.2E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-231569IPR009057Homeodomain-like
CDDcd001673.73E-81662No hitNo description
PROSITE profilePS5129421.52163117IPR017930Myb domain
SMARTSM007171.2E-1167115IPR001005SANT/Myb domain
PfamPF002492.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2370117IPR009057Homeodomain-like
CDDcd001674.77E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRAPCCDKA TVKRGPWSPE EDAMLKAYIE ERGTGNNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTPEEDSTIC KLYISIGSRW SIIAAQLPGR TDNDVKNYWN TKLKKRLLGG  120
RRKDRGAGTQ QHRQGELDGA NNDGEQQPLS ASAMERIQLC MQLQEMQNPL SSIGNHNNSL  180
HLWQPSSHHQ VAATHSNNSN SNSSRSSSFD VTVAAEQGQS SSLNGQHLGG QQQMETTAAA  240
DGLASPSSAG NSNIVTIEAE LQELLYSATT TTTDSVVTQQ GGVDWWSYDQ GKSPVNCWDF  300
TPETSSVLQD YAAVVYDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A2e-23141282124MYB3
3zqc_D2e-23141282124MYB3
3zqc_G2e-23141282124MYB3
3zqc_J2e-23141282124MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573606.11e-162PREDICTED: transcription factor RAX3
SwissprotQ9FKL21e-82MYB36_ARATH; Transcription factor MYB36
TrEMBLW4ZZB40.0W4ZZB4_WHEAT; Uncharacterized protein
STRINGMLOC_56989.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-75myb domain protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]